Anti PLVAP pAb (ATL-HPA002279)

Atlas Antibodies

Catalog No.: ATL-HPA002279-25

Protein Description: plasmalemma vesicle associated protein
Gene Name: PLVAP
Alternative Gene Name: FELS, gp68, PV-1, PV1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034845: 53%, ENSRNOG00000017676: 55%
Entrez Gene ID: 83483
Uniprot ID: Q9BX97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR
• Gene Sequence: KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR
• Gene ID - Mouse: ENSMUSG00000034845
• Gene ID - Rat: ENSRNOG00000017676
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLVAP pAb (ATL-HPA002279) – 3 Found

Phoenix, Timothy N; Patmore, Deanna M; Boop, Scott; Boulos, Nidal; Jacus, Megan O; Patel, Yogesh T; Roussel, Martine F; Finkelstein, David; Goumnerova, Liliana; Perreault, Sebastien; Wadhwa, Elizabeth; Cho, Yoon-Jae; Stewart, Clinton F; Gilbertson, Richard J. Medulloblastoma Genotype Dictates Blood Brain Barrier Phenotype. Cancer Cell. 2016;29(4):508-522. 

Baba, Takayuki; Grebe, Rhonda; Hasegawa, Takuya; Bhutto, Imran; Merges, Carol; McLeod, D Scott; Lutty, Gerard A. Maturation of the fetal human choriocapillaris. Investigative Ophthalmology & Visual Science. 2009;50(7):3503-11. 

Winkler, Ethan A; Kim, Chang N; Ross, Jayden M; Garcia, Joseph H; Gil, Eugene; Oh, Irene; Chen, Lindsay Q; Wu, David; Catapano, Joshua S; Raygor, Kunal; Narsinh, Kazim; Kim, Helen; Weinsheimer, Shantel; Cooke, Daniel L; Walcott, Brian P; Lawton, Michael T; Gupta, Nalin; Zlokovic, Berislav V; Chang, Edward F; Abla, Adib A; Lim, Daniel A; Nowakowski, Tomasz J. A single-cell atlas of the normal and malformed human brain vasculature. Science (New York, N.y.). 2022;375(6584):eabi7377.