Anti PLSCR3 pAb (ATL-HPA048387)

Atlas Antibodies

Catalog No.:
ATL-HPA048387-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: phospholipid scramblase 3
Gene Name: PLSCR3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019461: 94%, ENSRNOG00000027914: 91%
Entrez Gene ID: 57048
Uniprot ID: Q9NRY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFG
Gene Sequence PFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFG
Gene ID - Mouse ENSMUSG00000019461
Gene ID - Rat ENSRNOG00000027914
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLSCR3 pAb (ATL-HPA048387)
Datasheet Anti PLSCR3 pAb (ATL-HPA048387) Datasheet (External Link)
Vendor Page Anti PLSCR3 pAb (ATL-HPA048387) at Atlas Antibodies

Documents & Links for Anti PLSCR3 pAb (ATL-HPA048387)
Datasheet Anti PLSCR3 pAb (ATL-HPA048387) Datasheet (External Link)
Vendor Page Anti PLSCR3 pAb (ATL-HPA048387)