Anti PLRG1 pAb (ATL-HPA061486)

Atlas Antibodies

Catalog No.:
ATL-HPA061486-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pleiotropic regulator 1
Gene Name: PLRG1
Alternative Gene Name: Cwc1, PRL1, Prp46, PRPF46, TANGO4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027998: 94%, ENSRNOG00000006655: 93%
Entrez Gene ID: 5356
Uniprot ID: O43660
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGT
Gene Sequence VADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGT
Gene ID - Mouse ENSMUSG00000027998
Gene ID - Rat ENSRNOG00000006655
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLRG1 pAb (ATL-HPA061486)
Datasheet Anti PLRG1 pAb (ATL-HPA061486) Datasheet (External Link)
Vendor Page Anti PLRG1 pAb (ATL-HPA061486) at Atlas Antibodies

Documents & Links for Anti PLRG1 pAb (ATL-HPA061486)
Datasheet Anti PLRG1 pAb (ATL-HPA061486) Datasheet (External Link)
Vendor Page Anti PLRG1 pAb (ATL-HPA061486)