Anti PLPPR5 pAb (ATL-HPA059085)

Atlas Antibodies

SKU: ATL-HPA059085-25

• 

Protein Description: phospholipid phosphatase related 5
Gene Name: PLPPR5
Alternative Gene Name: LPPR5, PAP2, PAP2D, PRG5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033342: 100%, ENSRNOG00000016878: 100%
Entrez Gene ID: 163404
Uniprot ID: Q32ZL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKE
• Gene Sequence: PNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKE
• Gene ID - Mouse: ENSMUSG00000033342
• Gene ID - Rat: ENSRNOG00000016878
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.