Anti PLPPR3 pAb (ATL-HPA052293)

Atlas Antibodies

Catalog No.:
ATL-HPA052293-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: phospholipid phosphatase related 3
Gene Name: PLPPR3
Alternative Gene Name: FLJ11535, LPPR3, PRG-2, PRG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042002: 35%, ENSRNOG00000011752: 33%
Entrez Gene ID: 79948
Uniprot ID: Q6T4P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VYVSVSPAPHCPSQALLLTRGEPSLTPTPMPQMYFNSVISDTT
Gene Sequence VYVSVSPAPHCPSQALLLTRGEPSLTPTPMPQMYFNSVISDTT
Gene ID - Mouse ENSMUSG00000042002
Gene ID - Rat ENSRNOG00000011752
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLPPR3 pAb (ATL-HPA052293)
Datasheet Anti PLPPR3 pAb (ATL-HPA052293) Datasheet (External Link)
Vendor Page Anti PLPPR3 pAb (ATL-HPA052293) at Atlas Antibodies

Documents & Links for Anti PLPPR3 pAb (ATL-HPA052293)
Datasheet Anti PLPPR3 pAb (ATL-HPA052293) Datasheet (External Link)
Vendor Page Anti PLPPR3 pAb (ATL-HPA052293)