Anti PLPPR2 pAb (ATL-HPA048973)

Atlas Antibodies

SKU: ATL-HPA048973-25

• 
• 
• 

Protein Description: phospholipid phosphatase related 2
Gene Name: PLPPR2
Alternative Gene Name: LPPR2, PRG-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040563: 93%, ENSRNOG00000012164: 93%
Entrez Gene ID: 64748
Uniprot ID: Q96GM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHNFQSRPPSGRRLSPWEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTA
• Gene Sequence: VHNFQSRPPSGRRLSPWEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTA
• Gene ID - Mouse: ENSMUSG00000040563
• Gene ID - Rat: ENSRNOG00000012164
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.