Anti PLPPR2 pAb (ATL-HPA048973)

Atlas Antibodies

Catalog No.:
ATL-HPA048973-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phospholipid phosphatase related 2
Gene Name: PLPPR2
Alternative Gene Name: LPPR2, PRG-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040563: 93%, ENSRNOG00000012164: 93%
Entrez Gene ID: 64748
Uniprot ID: Q96GM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VHNFQSRPPSGRRLSPWEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTA
Gene Sequence VHNFQSRPPSGRRLSPWEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTA
Gene ID - Mouse ENSMUSG00000040563
Gene ID - Rat ENSRNOG00000012164
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLPPR2 pAb (ATL-HPA048973)
Datasheet Anti PLPPR2 pAb (ATL-HPA048973) Datasheet (External Link)
Vendor Page Anti PLPPR2 pAb (ATL-HPA048973) at Atlas Antibodies

Documents & Links for Anti PLPPR2 pAb (ATL-HPA048973)
Datasheet Anti PLPPR2 pAb (ATL-HPA048973) Datasheet (External Link)
Vendor Page Anti PLPPR2 pAb (ATL-HPA048973)