Anti PLPPR1 pAb (ATL-HPA014968)

Atlas Antibodies

Catalog No.: ATL-HPA014968-25

Protein Description: phospholipid phosphatase related 1
Gene Name: PLPPR1
Alternative Gene Name: FLJ20300, LPPR1, MGC26189, PRG-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063446: 88%, ENSRNOG00000007575: 84%
Entrez Gene ID: 54886
Uniprot ID: Q8TBJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSTRESLIAQEKTILTGECCYLNPLLRRIIRF
• Gene Sequence: KSTRESLIAQEKTILTGECCYLNPLLRRIIRF
• Gene ID - Mouse: ENSMUSG00000063446
• Gene ID - Rat: ENSRNOG00000007575
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.