Anti PLPP7 pAb (ATL-HPA070252)

Atlas Antibodies

Catalog No.:
ATL-HPA070252-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: phospholipid phosphatase 7 (inactive)
Gene Name: PLPP7
Alternative Gene Name: C9orf67, FLJ14662, MGC12921, NET39, PPAPDC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051373: 97%, ENSRNOG00000010068: 97%
Entrez Gene ID: 84814
Uniprot ID: Q8NBV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK
Gene Sequence GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK
Gene ID - Mouse ENSMUSG00000051373
Gene ID - Rat ENSRNOG00000010068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLPP7 pAb (ATL-HPA070252)
Datasheet Anti PLPP7 pAb (ATL-HPA070252) Datasheet (External Link)
Vendor Page Anti PLPP7 pAb (ATL-HPA070252) at Atlas Antibodies

Documents & Links for Anti PLPP7 pAb (ATL-HPA070252)
Datasheet Anti PLPP7 pAb (ATL-HPA070252) Datasheet (External Link)
Vendor Page Anti PLPP7 pAb (ATL-HPA070252)
Citations for Anti PLPP7 pAb (ATL-HPA070252) – 1 Found
Ramirez-Martinez, Andres; Zhang, Yichi; Chen, Kenian; Kim, Jiwoong; Cenik, Bercin K; McAnally, John R; Cai, Chunyu; Shelton, John M; Huang, Jian; Brennan, Ana; Evers, Bret M; Mammen, Pradeep P A; Xu, Lin; Bassel-Duby, Rhonda; Liu, Ning; Olson, Eric N. The nuclear envelope protein Net39 is essential for muscle nuclear integrity and chromatin organization. Nature Communications. 2021;12(1):690.  PubMed