Anti PLPP3 pAb (ATL-HPA072751)

Atlas Antibodies

Catalog No.: ATL-HPA072751-25

Protein Description: phospholipid phosphatase 3
Gene Name: PLPP3
Alternative Gene Name: LPP3, PAP-2b, PPAP2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028517: 92%, ENSRNOG00000008116: 89%
Entrez Gene ID: 8613
Uniprot ID: O14495
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM
• Gene Sequence: SDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM
• Gene ID - Mouse: ENSMUSG00000028517
• Gene ID - Rat: ENSRNOG00000008116
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.