Anti PLPP3 pAb (ATL-HPA072751)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072751-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PLPP3
Alternative Gene Name: LPP3, PAP-2b, PPAP2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028517: 92%, ENSRNOG00000008116: 89%
Entrez Gene ID: 8613
Uniprot ID: O14495
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM |
| Gene Sequence | SDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM |
| Gene ID - Mouse | ENSMUSG00000028517 |
| Gene ID - Rat | ENSRNOG00000008116 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLPP3 pAb (ATL-HPA072751) | |
| Datasheet | Anti PLPP3 pAb (ATL-HPA072751) Datasheet (External Link) |
| Vendor Page | Anti PLPP3 pAb (ATL-HPA072751) at Atlas Antibodies |
| Documents & Links for Anti PLPP3 pAb (ATL-HPA072751) | |
| Datasheet | Anti PLPP3 pAb (ATL-HPA072751) Datasheet (External Link) |
| Vendor Page | Anti PLPP3 pAb (ATL-HPA072751) |