Anti PLOD3 pAb (ATL-HPA001236 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001236-100

Protein Description: procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3
Gene Name: PLOD3
Alternative Gene Name: LH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004846: 92%, ENSRNOG00000001417: 93%
Entrez Gene ID: 8985
Uniprot ID: O60568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQLQDHFSAVKLVGPEEAL
• Gene Sequence: FDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQLQDHFSAVKLVGPEEAL
• Gene ID - Mouse: ENSMUSG00000004846
• Gene ID - Rat: ENSRNOG00000001417
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLOD3 pAb (ATL-HPA001236 w/enhanced validation) – 2 Found

Gross, Stephen J; Webb, Amelia M; Peterlin, Alek D; Durrant, Jessica R; Judson, Rachel J; Raza, Qanber; Kitajewski, Jan K; Kushner, Erich J. Notch regulates vascular collagen IV basement membrane through modulation of lysyl hydroxylase 3 trafficking. Angiogenesis. 2021;24(4):789-805. 

Djuric, Ugljesa; Lam, K H Brian; Kao, Jennifer; Batruch, Ihor; Jevtic, Stefan; Papaioannou, Michail-Dimitrios; Diamandis, Phedias. Defining Protein Pattern Differences Among Molecular Subtypes of Diffuse Gliomas Using Mass Spectrometry. Molecular & Cellular Proteomics : Mcp. 2019;18(10):2029-2043.