Anti PLOD1 pAb (ATL-HPA055799 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055799-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PLOD1
Alternative Gene Name: LH1, LLH, PLOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019055: 86%, ENSRNOG00000007763: 84%
Entrez Gene ID: 5351
Uniprot ID: Q02809
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANADARN |
| Gene Sequence | FVSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANADARN |
| Gene ID - Mouse | ENSMUSG00000019055 |
| Gene ID - Rat | ENSRNOG00000007763 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLOD1 pAb (ATL-HPA055799 w/enhanced validation) | |
| Datasheet | Anti PLOD1 pAb (ATL-HPA055799 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PLOD1 pAb (ATL-HPA055799 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PLOD1 pAb (ATL-HPA055799 w/enhanced validation) | |
| Datasheet | Anti PLOD1 pAb (ATL-HPA055799 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PLOD1 pAb (ATL-HPA055799 w/enhanced validation) |