Anti PLOD1 pAb (ATL-HPA049137 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA049137-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1
Gene Name: PLOD1
Alternative Gene Name: LH1, LLH, PLOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019055: 86%, ENSRNOG00000007763: 86%
Entrez Gene ID: 5351
Uniprot ID: Q02809
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSN
Gene Sequence YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSN
Gene ID - Mouse ENSMUSG00000019055
Gene ID - Rat ENSRNOG00000007763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLOD1 pAb (ATL-HPA049137 w/enhanced validation)
Datasheet Anti PLOD1 pAb (ATL-HPA049137 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLOD1 pAb (ATL-HPA049137 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PLOD1 pAb (ATL-HPA049137 w/enhanced validation)
Datasheet Anti PLOD1 pAb (ATL-HPA049137 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLOD1 pAb (ATL-HPA049137 w/enhanced validation)
Citations for Anti PLOD1 pAb (ATL-HPA049137 w/enhanced validation) – 1 Found
Gjaltema, Rutger A F; van der Stoel, Miesje M; Boersema, Miriam; Bank, Ruud A. Disentangling mechanisms involved in collagen pyridinoline cross-linking: The immunophilin FKBP65 is critical for dimerization of lysyl hydroxylase 2. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(26):7142-7.  PubMed