Anti PLIN3 pAb (ATL-HPA006427 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006427-25

Protein Description: perilipin 3
Gene Name: PLIN3
Alternative Gene Name: M6PRBP1, PP17, TIP47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024197: 71%, ENSRNOG00000048834: 71%
Entrez Gene ID: 10226
Uniprot ID: O60664
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLGKLRATKQRAQEALLQLSQALSLMETVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQVEDLQATFSSIHS
• Gene Sequence: SLGKLRATKQRAQEALLQLSQALSLMETVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQVEDLQATFSSIHS
• Gene ID - Mouse: ENSMUSG00000024197
• Gene ID - Rat: ENSRNOG00000048834
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLIN3 pAb (ATL-HPA006427 w/enhanced validation) – 2 Found

Akil, Abdellah; Peng, Juan; Omrane, Mohyeddine; Gondeau, Claire; Desterke, Christophe; Marin, Mickaël; Tronchère, Hélène; Taveneau, Cyntia; Sar, Sokhavuth; Briolotti, Philippe; Benjelloun, Soumaya; Benjouad, Abdelaziz; Maurel, Patrick; Thiers, Valérie; Bressanelli, Stéphane; Samuel, Didier; Bréchot, Christian; Gassama-Diagne, Ama. Septin 9 induces lipid droplets growth by a phosphatidylinositol-5-phosphate and microtubule-dependent mechanism hijacked by HCV. Nature Communications. 2016;7( 27417143):12203. 

Vogt, Dorothee A; Camus, Grégory; Herker, Eva; Webster, Brian R; Tsou, Chia-Lin; Greene, Warner C; Yen, Tien-Sze Benedict; Ott, Melanie. Lipid droplet-binding protein TIP47 regulates hepatitis C Virus RNA replication through interaction with the viral NS5A protein. Plos Pathogens. 9(4):e1003302.