Anti PLGRKT pAb (ATL-HPA008214 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008214-25

Protein Description: plasminogen receptor, C-terminal lysine transmembrane protein
Gene Name: PLGRKT
Alternative Gene Name: AD025, C9orf46, FLJ14688, MDS030, Plg-RKT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016495: 81%, ENSRNOG00000015932: 89%
Entrez Gene ID: 55848
Uniprot ID: Q9HBL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSRE
• Gene Sequence: QKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSRE
• Gene ID - Mouse: ENSMUSG00000016495
• Gene ID - Rat: ENSRNOG00000015932
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.