Anti PLGLB1 pAb (ATL-HPA053770)

Atlas Antibodies

Catalog No.:
ATL-HPA053770-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: plasminogen-like B1
Gene Name: PLGLB1
Alternative Gene Name: PLGL, PRP-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059481: 84%, ENSRNOG00000017223: 84%
Entrez Gene ID: 5343
Uniprot ID: Q02325
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTCRAFQYHSKEQQCVIMAENRKSSIIIRMRD
Gene Sequence FTCRAFQYHSKEQQCVIMAENRKSSIIIRMRD
Gene ID - Mouse ENSMUSG00000059481
Gene ID - Rat ENSRNOG00000017223
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLGLB1 pAb (ATL-HPA053770)
Datasheet Anti PLGLB1 pAb (ATL-HPA053770) Datasheet (External Link)
Vendor Page Anti PLGLB1 pAb (ATL-HPA053770) at Atlas Antibodies

Documents & Links for Anti PLGLB1 pAb (ATL-HPA053770)
Datasheet Anti PLGLB1 pAb (ATL-HPA053770) Datasheet (External Link)
Vendor Page Anti PLGLB1 pAb (ATL-HPA053770)