Anti PLG pAb (ATL-HPA021602)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021602-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: PLG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059481: 81%, ENSRNOG00000017223: 82%
Entrez Gene ID: 5340
Uniprot ID: P00747
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE |
Gene Sequence | NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE |
Gene ID - Mouse | ENSMUSG00000059481 |
Gene ID - Rat | ENSRNOG00000017223 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PLG pAb (ATL-HPA021602) | |
Datasheet | Anti PLG pAb (ATL-HPA021602) Datasheet (External Link) |
Vendor Page | Anti PLG pAb (ATL-HPA021602) at Atlas Antibodies |
Documents & Links for Anti PLG pAb (ATL-HPA021602) | |
Datasheet | Anti PLG pAb (ATL-HPA021602) Datasheet (External Link) |
Vendor Page | Anti PLG pAb (ATL-HPA021602) |
Citations for Anti PLG pAb (ATL-HPA021602) – 2 Found |
Gründel, Anne; Friedrich, Kathleen; Pfeiffer, Melanie; Jacobs, Enno; Dumke, Roger. Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen. Plos One. 10(5):e0126600. PubMed |
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |