Anti PLEKHM1 pAb (ATL-HPA025018)

Atlas Antibodies

Catalog No.: ATL-HPA025018-25

Protein Description: pleckstrin homology domain containing, family M (with RUN domain) member 1
Gene Name: PLEKHM1
Alternative Gene Name: KIAA0356
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034247: 76%, ENSRNOG00000028521: 77%
Entrez Gene ID: 9842
Uniprot ID: Q9Y4G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDHCEEPMSCDSDLGTANAEDSDRSLQEVLLEFSKAQVNSVPTNGLSQETEIPTPQASLSLHGLNTSTYLHCEAP
• Gene Sequence: LTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDHCEEPMSCDSDLGTANAEDSDRSLQEVLLEFSKAQVNSVPTNGLSQETEIPTPQASLSLHGLNTSTYLHCEAP
• Gene ID - Mouse: ENSMUSG00000034247
• Gene ID - Rat: ENSRNOG00000028521
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLEKHM1 pAb (ATL-HPA025018) – 2 Found

Rogov, Vladimir V; Stolz, Alexandra; Ravichandran, Arvind C; Rios-Szwed, Diana O; Suzuki, Hironori; Kniss, Andreas; Löhr, Frank; Wakatsuki, Soichi; Dötsch, Volker; Dikic, Ivan; Dobson, Renwick Cj; McEwan, David G. Structural and functional analysis of the GABARAP interaction motif (GIM). Embo Reports. 2017;18(8):1382-1396. 

Herhaus, Lina; Bhaskara, Ramachandra M; Lystad, Alf Håkon; Gestal-Mato, Uxía; Covarrubias-Pinto, Adriana; Bonn, Florian; Simonsen, Anne; Hummer, Gerhard; Dikic, Ivan. TBK1-mediated phosphorylation of LC3C and GABARAP-L2 controls autophagosome shedding by ATG4 protease. Embo Reports. 2020;21(1):e48317.