Anti PLEKHJ1 pAb (ATL-HPA048989)

Atlas Antibodies

SKU: ATL-HPA048989-25

• 
• 

Protein Description: pleckstrin homology domain containing, family J member 1
Gene Name: PLEKHJ1
Alternative Gene Name: FLJ10297
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035278: 83%, ENSRNOG00000019247: 87%
Entrez Gene ID: 55111
Uniprot ID: Q9NW61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGL
• Gene Sequence: FIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGL
• Gene ID - Mouse: ENSMUSG00000035278
• Gene ID - Rat: ENSRNOG00000019247
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.