Anti PLEKHJ1 pAb (ATL-HPA048989)

Atlas Antibodies

Catalog No.:
ATL-HPA048989-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology domain containing, family J member 1
Gene Name: PLEKHJ1
Alternative Gene Name: FLJ10297
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035278: 83%, ENSRNOG00000019247: 87%
Entrez Gene ID: 55111
Uniprot ID: Q9NW61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGL
Gene Sequence FIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGL
Gene ID - Mouse ENSMUSG00000035278
Gene ID - Rat ENSRNOG00000019247
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLEKHJ1 pAb (ATL-HPA048989)
Datasheet Anti PLEKHJ1 pAb (ATL-HPA048989) Datasheet (External Link)
Vendor Page Anti PLEKHJ1 pAb (ATL-HPA048989) at Atlas Antibodies

Documents & Links for Anti PLEKHJ1 pAb (ATL-HPA048989)
Datasheet Anti PLEKHJ1 pAb (ATL-HPA048989) Datasheet (External Link)
Vendor Page Anti PLEKHJ1 pAb (ATL-HPA048989)