Anti PLEKHG7 pAb (ATL-HPA060632)

Atlas Antibodies

Catalog No.:
ATL-HPA060632-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 7
Gene Name: PLEKHG7
Alternative Gene Name: FLJ46688
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064120: 23%, ENSRNOG00000047165: 22%
Entrez Gene ID: 440107
Uniprot ID: Q6ZR37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCFTKSQETKKI
Gene Sequence IKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCFTKSQETKKI
Gene ID - Mouse ENSMUSG00000064120
Gene ID - Rat ENSRNOG00000047165
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLEKHG7 pAb (ATL-HPA060632)
Datasheet Anti PLEKHG7 pAb (ATL-HPA060632) Datasheet (External Link)
Vendor Page Anti PLEKHG7 pAb (ATL-HPA060632) at Atlas Antibodies

Documents & Links for Anti PLEKHG7 pAb (ATL-HPA060632)
Datasheet Anti PLEKHG7 pAb (ATL-HPA060632) Datasheet (External Link)
Vendor Page Anti PLEKHG7 pAb (ATL-HPA060632)