Anti PLEKHG6 pAb (ATL-HPA058230)

Atlas Antibodies

Catalog No.:
ATL-HPA058230-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 6
Gene Name: PLEKHG6
Alternative Gene Name: FLJ10665, MYOGEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038167: 77%, ENSRNOG00000019528: 73%
Entrez Gene ID: 55200
Uniprot ID: Q3KR16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAFGPPHEGPLQGLVASRIETYGGRHRASAQSTTGRLYPRGYPVLDPSRRRLQQYVPFARGSGQARGLSPMRLRDPEPEKR
Gene Sequence KAFGPPHEGPLQGLVASRIETYGGRHRASAQSTTGRLYPRGYPVLDPSRRRLQQYVPFARGSGQARGLSPMRLRDPEPEKR
Gene ID - Mouse ENSMUSG00000038167
Gene ID - Rat ENSRNOG00000019528
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLEKHG6 pAb (ATL-HPA058230)
Datasheet Anti PLEKHG6 pAb (ATL-HPA058230) Datasheet (External Link)
Vendor Page Anti PLEKHG6 pAb (ATL-HPA058230) at Atlas Antibodies

Documents & Links for Anti PLEKHG6 pAb (ATL-HPA058230)
Datasheet Anti PLEKHG6 pAb (ATL-HPA058230) Datasheet (External Link)
Vendor Page Anti PLEKHG6 pAb (ATL-HPA058230)