Anti PLEKHG5 pAb (ATL-HPA049570)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049570-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PLEKHG5
Alternative Gene Name: GEF720, KIAA0720, Syx, Tech
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039713: 98%, ENSRNOG00000022694: 98%
Entrez Gene ID: 57449
Uniprot ID: O94827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQSNTPLSL |
| Gene Sequence | KGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQSNTPLSL |
| Gene ID - Mouse | ENSMUSG00000039713 |
| Gene ID - Rat | ENSRNOG00000022694 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLEKHG5 pAb (ATL-HPA049570) | |
| Datasheet | Anti PLEKHG5 pAb (ATL-HPA049570) Datasheet (External Link) |
| Vendor Page | Anti PLEKHG5 pAb (ATL-HPA049570) at Atlas Antibodies |
| Documents & Links for Anti PLEKHG5 pAb (ATL-HPA049570) | |
| Datasheet | Anti PLEKHG5 pAb (ATL-HPA049570) Datasheet (External Link) |
| Vendor Page | Anti PLEKHG5 pAb (ATL-HPA049570) |