Anti PLEKHG5 pAb (ATL-HPA049570)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049570-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PLEKHG5
Alternative Gene Name: GEF720, KIAA0720, Syx, Tech
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039713: 98%, ENSRNOG00000022694: 98%
Entrez Gene ID: 57449
Uniprot ID: O94827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQSNTPLSL |
Gene Sequence | KGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQSNTPLSL |
Gene ID - Mouse | ENSMUSG00000039713 |
Gene ID - Rat | ENSRNOG00000022694 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PLEKHG5 pAb (ATL-HPA049570) | |
Datasheet | Anti PLEKHG5 pAb (ATL-HPA049570) Datasheet (External Link) |
Vendor Page | Anti PLEKHG5 pAb (ATL-HPA049570) at Atlas Antibodies |
Documents & Links for Anti PLEKHG5 pAb (ATL-HPA049570) | |
Datasheet | Anti PLEKHG5 pAb (ATL-HPA049570) Datasheet (External Link) |
Vendor Page | Anti PLEKHG5 pAb (ATL-HPA049570) |