Anti PLEKHG5 pAb (ATL-HPA049570)

Atlas Antibodies

Catalog No.:
ATL-HPA049570-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 5
Gene Name: PLEKHG5
Alternative Gene Name: GEF720, KIAA0720, Syx, Tech
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039713: 98%, ENSRNOG00000022694: 98%
Entrez Gene ID: 57449
Uniprot ID: O94827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQSNTPLSL
Gene Sequence KGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQSNTPLSL
Gene ID - Mouse ENSMUSG00000039713
Gene ID - Rat ENSRNOG00000022694
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLEKHG5 pAb (ATL-HPA049570)
Datasheet Anti PLEKHG5 pAb (ATL-HPA049570) Datasheet (External Link)
Vendor Page Anti PLEKHG5 pAb (ATL-HPA049570) at Atlas Antibodies

Documents & Links for Anti PLEKHG5 pAb (ATL-HPA049570)
Datasheet Anti PLEKHG5 pAb (ATL-HPA049570) Datasheet (External Link)
Vendor Page Anti PLEKHG5 pAb (ATL-HPA049570)