Anti PLEKHG4 pAb (ATL-HPA055696)

Atlas Antibodies

Catalog No.: ATL-HPA055696-25

Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 4
Gene Name: PLEKHG4
Alternative Gene Name: ARHGEF44, DKFZP434I216, SCA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014782: 77%, ENSRNOG00000016479: 80%
Entrez Gene ID: 25894
Uniprot ID: Q58EX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGVGNKAFRDIAPSEEAINDRTVNYVLKCREVRSRASIAVAPFDHDSLYLGASNSLPGDPASCSVLGSLNLHLYRDPALLGLRCPLYPSFP
• Gene Sequence: MGVGNKAFRDIAPSEEAINDRTVNYVLKCREVRSRASIAVAPFDHDSLYLGASNSLPGDPASCSVLGSLNLHLYRDPALLGLRCPLYPSFP
• Gene ID - Mouse: ENSMUSG00000014782
• Gene ID - Rat: ENSRNOG00000016479
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.