Anti PLEKHG4 pAb (ATL-HPA055696)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055696-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PLEKHG4
Alternative Gene Name: ARHGEF44, DKFZP434I216, SCA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014782: 77%, ENSRNOG00000016479: 80%
Entrez Gene ID: 25894
Uniprot ID: Q58EX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MGVGNKAFRDIAPSEEAINDRTVNYVLKCREVRSRASIAVAPFDHDSLYLGASNSLPGDPASCSVLGSLNLHLYRDPALLGLRCPLYPSFP |
| Gene Sequence | MGVGNKAFRDIAPSEEAINDRTVNYVLKCREVRSRASIAVAPFDHDSLYLGASNSLPGDPASCSVLGSLNLHLYRDPALLGLRCPLYPSFP |
| Gene ID - Mouse | ENSMUSG00000014782 |
| Gene ID - Rat | ENSRNOG00000016479 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLEKHG4 pAb (ATL-HPA055696) | |
| Datasheet | Anti PLEKHG4 pAb (ATL-HPA055696) Datasheet (External Link) |
| Vendor Page | Anti PLEKHG4 pAb (ATL-HPA055696) at Atlas Antibodies |
| Documents & Links for Anti PLEKHG4 pAb (ATL-HPA055696) | |
| Datasheet | Anti PLEKHG4 pAb (ATL-HPA055696) Datasheet (External Link) |
| Vendor Page | Anti PLEKHG4 pAb (ATL-HPA055696) |