Anti PLEKHG3 pAb (ATL-HPA065323)

Atlas Antibodies

Catalog No.:
ATL-HPA065323-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 3
Gene Name: PLEKHG3
Alternative Gene Name: ARHGEF43, KIAA0599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052609: 69%, ENSRNOG00000006570: 68%
Entrez Gene ID: 26030
Uniprot ID: A1L390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDGGETLYVTADLTLEDNRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPSQQGR
Gene Sequence PDGGETLYVTADLTLEDNRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPSQQGR
Gene ID - Mouse ENSMUSG00000052609
Gene ID - Rat ENSRNOG00000006570
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLEKHG3 pAb (ATL-HPA065323)
Datasheet Anti PLEKHG3 pAb (ATL-HPA065323) Datasheet (External Link)
Vendor Page Anti PLEKHG3 pAb (ATL-HPA065323) at Atlas Antibodies

Documents & Links for Anti PLEKHG3 pAb (ATL-HPA065323)
Datasheet Anti PLEKHG3 pAb (ATL-HPA065323) Datasheet (External Link)
Vendor Page Anti PLEKHG3 pAb (ATL-HPA065323)