Anti PLEKHD1 pAb (ATL-HPA051875)

Atlas Antibodies

Catalog No.:
ATL-HPA051875-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology domain containing, family D (with coiled-coil domains) member 1
Gene Name: PLEKHD1
Alternative Gene Name: UPF0639
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066438: 99%, ENSRNOG00000038297: 99%
Entrez Gene ID: 400224
Uniprot ID: A6NEE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYAMKISHQDFHGNILLAAESEFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQREQR
Gene Sequence PYAMKISHQDFHGNILLAAESEFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQREQR
Gene ID - Mouse ENSMUSG00000066438
Gene ID - Rat ENSRNOG00000038297
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLEKHD1 pAb (ATL-HPA051875)
Datasheet Anti PLEKHD1 pAb (ATL-HPA051875) Datasheet (External Link)
Vendor Page Anti PLEKHD1 pAb (ATL-HPA051875) at Atlas Antibodies

Documents & Links for Anti PLEKHD1 pAb (ATL-HPA051875)
Datasheet Anti PLEKHD1 pAb (ATL-HPA051875) Datasheet (External Link)
Vendor Page Anti PLEKHD1 pAb (ATL-HPA051875)