Anti PLEKHB2 pAb (ATL-HPA075014)

Atlas Antibodies

Catalog No.: ATL-HPA075014-25

Protein Description: pleckstrin homology domain containing B2
Gene Name: PLEKHB2
Alternative Gene Name: EVT2, FLJ20783
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026123: 95%, ENSRNOG00000014162: 94%
Entrez Gene ID: 55041
Uniprot ID: Q96CS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM
• Gene Sequence: YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM
• Gene ID - Mouse: ENSMUSG00000026123
• Gene ID - Rat: ENSRNOG00000014162
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.