Anti PLEKHB2 pAb (ATL-HPA075014)

Atlas Antibodies

Catalog No.:
ATL-HPA075014-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology domain containing B2
Gene Name: PLEKHB2
Alternative Gene Name: EVT2, FLJ20783
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026123: 95%, ENSRNOG00000014162: 94%
Entrez Gene ID: 55041
Uniprot ID: Q96CS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM
Gene Sequence YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM
Gene ID - Mouse ENSMUSG00000026123
Gene ID - Rat ENSRNOG00000014162
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLEKHB2 pAb (ATL-HPA075014)
Datasheet Anti PLEKHB2 pAb (ATL-HPA075014) Datasheet (External Link)
Vendor Page Anti PLEKHB2 pAb (ATL-HPA075014) at Atlas Antibodies

Documents & Links for Anti PLEKHB2 pAb (ATL-HPA075014)
Datasheet Anti PLEKHB2 pAb (ATL-HPA075014) Datasheet (External Link)
Vendor Page Anti PLEKHB2 pAb (ATL-HPA075014)