Anti PLEKHA8 pAb (ATL-HPA072314)

Atlas Antibodies

SKU:
ATL-HPA072314-25
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 8
Gene Name: PLEKHA8
Alternative Gene Name: FAPP2, MGC3358
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005225: 85%, ENSRNOG00000009971: 78%
Entrez Gene ID: 84725
Uniprot ID: Q96JA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNSLERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIMK
Gene Sequence TSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNSLERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIMK
Gene ID - Mouse ENSMUSG00000005225
Gene ID - Rat ENSRNOG00000009971
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PLEKHA8 pAb (ATL-HPA072314)
Datasheet Anti PLEKHA8 pAb (ATL-HPA072314) Datasheet (External Link)
Vendor Page Anti PLEKHA8 pAb (ATL-HPA072314) at Atlas Antibodies

Documents & Links for Anti PLEKHA8 pAb (ATL-HPA072314)
Datasheet Anti PLEKHA8 pAb (ATL-HPA072314) Datasheet (External Link)
Vendor Page Anti PLEKHA8 pAb (ATL-HPA072314)