Anti PLEKHA6 pAb (ATL-HPA028152)

Atlas Antibodies

Catalog No.: ATL-HPA028152-25

Protein Description: pleckstrin homology domain containing, family A member 6
Gene Name: PLEKHA6
Alternative Gene Name: KIAA0969, PEPP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041757: 98%, ENSRNOG00000024602: 32%
Entrez Gene ID: 22874
Uniprot ID: Q9Y2H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SIHEVDISNLEAALRAEEPGGHAYETPREEIARLRKMELEPQHYDVDINKELSTPDKVLIPERYIDLEPDTPLSPEELKEKQ
• Gene Sequence: SIHEVDISNLEAALRAEEPGGHAYETPREEIARLRKMELEPQHYDVDINKELSTPDKVLIPERYIDLEPDTPLSPEELKEKQ
• Gene ID - Mouse: ENSMUSG00000041757
• Gene ID - Rat: ENSRNOG00000024602
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLEKHA6 pAb (ATL-HPA028152) – 1 Found

Gallegos, Lisa Leon; Ng, Mei Rosa; Sowa, Mathew E; Selfors, Laura M; White, Anne; Zervantonakis, Ioannis K; Singh, Pragya; Dhakal, Sabin; Harper, J Wade; Brugge, Joan S. A protein interaction map for cell-cell adhesion regulators identifies DUSP23 as a novel phosphatase for β-catenin. Scientific Reports. 2016;6( 27255161):27114.