Anti PLEKHA2 pAb (ATL-HPA004706)

Atlas Antibodies

Catalog No.: ATL-HPA004706-25

Protein Description: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 2
Gene Name: PLEKHA2
Alternative Gene Name: TAPP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031557: 89%, ENSRNOG00000038365: 88%
Entrez Gene ID: 59339
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAGAVGALQLTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDMKDWVEALNQASKITVPKGGGLPMTTEVLKSLAAPPALEKKPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILRRSQSYIPTS
• Gene Sequence: GAGAVGALQLTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDMKDWVEALNQASKITVPKGGGLPMTTEVLKSLAAPPALEKKPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILRRSQSYIPTS
• Gene ID - Mouse: ENSMUSG00000031557
• Gene ID - Rat: ENSRNOG00000038365
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.