Anti PLEK pAb (ATL-HPA057341)

Atlas Antibodies

Catalog No.:
ATL-HPA057341-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pleckstrin
Gene Name: PLEK
Alternative Gene Name: P47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020120: 92%, ENSRNOG00000005214: 92%
Entrez Gene ID: 5341
Uniprot ID: P08567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFLEERDAWVRDINKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNC
Gene Sequence AFLEERDAWVRDINKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNC
Gene ID - Mouse ENSMUSG00000020120
Gene ID - Rat ENSRNOG00000005214
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLEK pAb (ATL-HPA057341)
Datasheet Anti PLEK pAb (ATL-HPA057341) Datasheet (External Link)
Vendor Page Anti PLEK pAb (ATL-HPA057341) at Atlas Antibodies

Documents & Links for Anti PLEK pAb (ATL-HPA057341)
Datasheet Anti PLEK pAb (ATL-HPA057341) Datasheet (External Link)
Vendor Page Anti PLEK pAb (ATL-HPA057341)