Anti PLEC pAb (ATL-HPA025967 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025967-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $395.00
    
         
                            Gene Name: PLEC
Alternative Gene Name: EBS1, PCN, PLEC1, PLTN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 87%, ENSRNOG00000023781: 91%
Entrez Gene ID: 5339
Uniprot ID: Q15149
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | LTGLSLLPLSEKAARARQEELYSELQARETFEKTPVEVPVGGFKGRTVTVWELISSEYFTAEQRQELLRQFRTGKVTVEKVIKILIT | 
| Gene Sequence | LTGLSLLPLSEKAARARQEELYSELQARETFEKTPVEVPVGGFKGRTVTVWELISSEYFTAEQRQELLRQFRTGKVTVEKVIKILIT | 
| Gene ID - Mouse | ENSMUSG00000022565 | 
| Gene ID - Rat | ENSRNOG00000023781 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti PLEC pAb (ATL-HPA025967 w/enhanced validation) | |
| Datasheet | Anti PLEC pAb (ATL-HPA025967 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti PLEC pAb (ATL-HPA025967 w/enhanced validation) at Atlas Antibodies | 
| Documents & Links for Anti PLEC pAb (ATL-HPA025967 w/enhanced validation) | |
| Datasheet | Anti PLEC pAb (ATL-HPA025967 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti PLEC pAb (ATL-HPA025967 w/enhanced validation) | 
 
         
                             
                                        