Anti PLD5 pAb (ATL-HPA050367)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050367-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PLD5
Alternative Gene Name: FLJ40773
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055214: 94%, ENSRNOG00000003997: 95%
Entrez Gene ID: 200150
Uniprot ID: Q8N7P1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PISSTSTKRTYWPDLDAKIREALVLRSVRVRLLLSFWKETDPLTFNFISSLKAICTEIANCSLKVKFFDLERENACATKEQKNHT |
Gene Sequence | PISSTSTKRTYWPDLDAKIREALVLRSVRVRLLLSFWKETDPLTFNFISSLKAICTEIANCSLKVKFFDLERENACATKEQKNHT |
Gene ID - Mouse | ENSMUSG00000055214 |
Gene ID - Rat | ENSRNOG00000003997 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PLD5 pAb (ATL-HPA050367) | |
Datasheet | Anti PLD5 pAb (ATL-HPA050367) Datasheet (External Link) |
Vendor Page | Anti PLD5 pAb (ATL-HPA050367) at Atlas Antibodies |
Documents & Links for Anti PLD5 pAb (ATL-HPA050367) | |
Datasheet | Anti PLD5 pAb (ATL-HPA050367) Datasheet (External Link) |
Vendor Page | Anti PLD5 pAb (ATL-HPA050367) |