Anti PLD5 pAb (ATL-HPA050367)

Atlas Antibodies

Catalog No.:
ATL-HPA050367-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phospholipase D family, member 5
Gene Name: PLD5
Alternative Gene Name: FLJ40773
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055214: 94%, ENSRNOG00000003997: 95%
Entrez Gene ID: 200150
Uniprot ID: Q8N7P1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PISSTSTKRTYWPDLDAKIREALVLRSVRVRLLLSFWKETDPLTFNFISSLKAICTEIANCSLKVKFFDLERENACATKEQKNHT
Gene Sequence PISSTSTKRTYWPDLDAKIREALVLRSVRVRLLLSFWKETDPLTFNFISSLKAICTEIANCSLKVKFFDLERENACATKEQKNHT
Gene ID - Mouse ENSMUSG00000055214
Gene ID - Rat ENSRNOG00000003997
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLD5 pAb (ATL-HPA050367)
Datasheet Anti PLD5 pAb (ATL-HPA050367) Datasheet (External Link)
Vendor Page Anti PLD5 pAb (ATL-HPA050367) at Atlas Antibodies

Documents & Links for Anti PLD5 pAb (ATL-HPA050367)
Datasheet Anti PLD5 pAb (ATL-HPA050367) Datasheet (External Link)
Vendor Page Anti PLD5 pAb (ATL-HPA050367)