Anti PLD4 pAb (ATL-HPA051512)

Atlas Antibodies

Catalog No.: ATL-HPA051512-25

Protein Description: phospholipase D family, member 4
Gene Name: PLD4
Alternative Gene Name: C14orf175
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052160: 80%, ENSRNOG00000028566: 81%
Entrez Gene ID: 122618
Uniprot ID: Q96BZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFP
• Gene Sequence: AQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFP
• Gene ID - Mouse: ENSMUSG00000052160
• Gene ID - Rat: ENSRNOG00000028566
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.