Anti PLD4 pAb (ATL-HPA051512)

Atlas Antibodies

Catalog No.:
ATL-HPA051512-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phospholipase D family, member 4
Gene Name: PLD4
Alternative Gene Name: C14orf175
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052160: 80%, ENSRNOG00000028566: 81%
Entrez Gene ID: 122618
Uniprot ID: Q96BZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFP
Gene Sequence AQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFP
Gene ID - Mouse ENSMUSG00000052160
Gene ID - Rat ENSRNOG00000028566
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLD4 pAb (ATL-HPA051512)
Datasheet Anti PLD4 pAb (ATL-HPA051512) Datasheet (External Link)
Vendor Page Anti PLD4 pAb (ATL-HPA051512) at Atlas Antibodies

Documents & Links for Anti PLD4 pAb (ATL-HPA051512)
Datasheet Anti PLD4 pAb (ATL-HPA051512) Datasheet (External Link)
Vendor Page Anti PLD4 pAb (ATL-HPA051512)