Anti PLD1 pAb (ATL-HPA042396 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA042396-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: phospholipase D1, phosphatidylcholine-specific
Gene Name: PLD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027695: 90%, ENSRNOG00000028156: 85%
Entrez Gene ID: 5337
Uniprot ID: Q13393
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSAIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKFKHFQEFHR
Gene Sequence NEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSAIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKFKHFQEFHR
Gene ID - Mouse ENSMUSG00000027695
Gene ID - Rat ENSRNOG00000028156
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLD1 pAb (ATL-HPA042396 w/enhanced validation)
Datasheet Anti PLD1 pAb (ATL-HPA042396 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLD1 pAb (ATL-HPA042396 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PLD1 pAb (ATL-HPA042396 w/enhanced validation)
Datasheet Anti PLD1 pAb (ATL-HPA042396 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLD1 pAb (ATL-HPA042396 w/enhanced validation)