Anti PLCXD1 pAb (ATL-HPA007721)

Atlas Antibodies

Catalog No.: ATL-HPA007721-25

Protein Description: phosphatidylinositol-specific phospholipase C, X domain containing 1
Gene Name: PLCXD1
Alternative Gene Name: FLJ11323
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064247: 77%, ENSRNOG00000049866: 76%
Entrez Gene ID: 55344
Uniprot ID: Q9NUJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEWL
• Gene Sequence: LHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEWL
• Gene ID - Mouse: ENSMUSG00000064247
• Gene ID - Rat: ENSRNOG00000049866
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.