Anti PLCL2 pAb (ATL-HPA061728)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061728-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PLCL2
Alternative Gene Name: KIAA1092, PLCE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038910: 89%, ENSRNOG00000013368: 88%
Entrez Gene ID: 23228
Uniprot ID: Q9UPR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE |
| Gene Sequence | ITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE |
| Gene ID - Mouse | ENSMUSG00000038910 |
| Gene ID - Rat | ENSRNOG00000013368 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLCL2 pAb (ATL-HPA061728) | |
| Datasheet | Anti PLCL2 pAb (ATL-HPA061728) Datasheet (External Link) |
| Vendor Page | Anti PLCL2 pAb (ATL-HPA061728) at Atlas Antibodies |
| Documents & Links for Anti PLCL2 pAb (ATL-HPA061728) | |
| Datasheet | Anti PLCL2 pAb (ATL-HPA061728) Datasheet (External Link) |
| Vendor Page | Anti PLCL2 pAb (ATL-HPA061728) |