Anti PLCH1 pAb (ATL-HPA057978)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057978-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PLCH1
Alternative Gene Name: DKFZp434C1372, KIAA1069, MGC117152, PLCeta1, PLCL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036834: 54%, ENSRNOG00000009955: 54%
Entrez Gene ID: 23007
Uniprot ID: Q4KWH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ETTKHATNTVYETTCTPISKTKPDDDLSSKAKTAALESNLPGSPNTSRGWLPKSPTKGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGE |
| Gene Sequence | ETTKHATNTVYETTCTPISKTKPDDDLSSKAKTAALESNLPGSPNTSRGWLPKSPTKGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGE |
| Gene ID - Mouse | ENSMUSG00000036834 |
| Gene ID - Rat | ENSRNOG00000009955 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLCH1 pAb (ATL-HPA057978) | |
| Datasheet | Anti PLCH1 pAb (ATL-HPA057978) Datasheet (External Link) |
| Vendor Page | Anti PLCH1 pAb (ATL-HPA057978) at Atlas Antibodies |
| Documents & Links for Anti PLCH1 pAb (ATL-HPA057978) | |
| Datasheet | Anti PLCH1 pAb (ATL-HPA057978) Datasheet (External Link) |
| Vendor Page | Anti PLCH1 pAb (ATL-HPA057978) |