Anti PLCG2 pAb (ATL-HPA020100 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020100-25

Protein Description: phospholipase C, gamma 2 (phosphatidylinositol-specific)
Gene Name: PLCG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034330: 90%, ENSRNOG00000051986: 93%
Entrez Gene ID: 5336
Uniprot ID: P16885
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKK
• Gene Sequence: FGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKK
• Gene ID - Mouse: ENSMUSG00000034330
• Gene ID - Rat: ENSRNOG00000051986
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLCG2 pAb (ATL-HPA020100 w/enhanced validation) – 1 Found

Chan, Joseph M; Quintanal-Villalonga, Álvaro; Gao, Vianne Ran; Xie, Yubin; Allaj, Viola; Chaudhary, Ojasvi; Masilionis, Ignas; Egger, Jacklynn; Chow, Andrew; Walle, Thomas; Mattar, Marissa; Yarlagadda, Dig V K; Wang, James L; Uddin, Fathema; Offin, Michael; Ciampricotti, Metamia; Qeriqi, Besnik; Bahr, Amber; de Stanchina, Elisa; Bhanot, Umesh K; Lai, W Victoria; Bott, Matthew J; Jones, David R; Ruiz, Arvin; Baine, Marina K; Li, Yanyun; Rekhtman, Natasha; Poirier, John T; Nawy, Tal; Sen, Triparna; Mazutis, Linas; Hollmann, Travis J; Pe'er, Dana; Rudin, Charles M. Signatures of plasticity, metastasis, and immunosuppression in an atlas of human small cell lung cancer. Cancer Cell. 2021;39(11):1479-1496.e18.