Anti PLCG2 pAb (ATL-HPA020100 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020100-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PLCG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034330: 90%, ENSRNOG00000051986: 93%
Entrez Gene ID: 5336
Uniprot ID: P16885
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKK |
| Gene Sequence | FGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKK |
| Gene ID - Mouse | ENSMUSG00000034330 |
| Gene ID - Rat | ENSRNOG00000051986 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLCG2 pAb (ATL-HPA020100 w/enhanced validation) | |
| Datasheet | Anti PLCG2 pAb (ATL-HPA020100 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PLCG2 pAb (ATL-HPA020100 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PLCG2 pAb (ATL-HPA020100 w/enhanced validation) | |
| Datasheet | Anti PLCG2 pAb (ATL-HPA020100 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PLCG2 pAb (ATL-HPA020100 w/enhanced validation) |
| Citations for Anti PLCG2 pAb (ATL-HPA020100 w/enhanced validation) – 1 Found |
| Chan, Joseph M; Quintanal-Villalonga, Álvaro; Gao, Vianne Ran; Xie, Yubin; Allaj, Viola; Chaudhary, Ojasvi; Masilionis, Ignas; Egger, Jacklynn; Chow, Andrew; Walle, Thomas; Mattar, Marissa; Yarlagadda, Dig V K; Wang, James L; Uddin, Fathema; Offin, Michael; Ciampricotti, Metamia; Qeriqi, Besnik; Bahr, Amber; de Stanchina, Elisa; Bhanot, Umesh K; Lai, W Victoria; Bott, Matthew J; Jones, David R; Ruiz, Arvin; Baine, Marina K; Li, Yanyun; Rekhtman, Natasha; Poirier, John T; Nawy, Tal; Sen, Triparna; Mazutis, Linas; Hollmann, Travis J; Pe'er, Dana; Rudin, Charles M. Signatures of plasticity, metastasis, and immunosuppression in an atlas of human small cell lung cancer. Cancer Cell. 2021;39(11):1479-1496.e18. PubMed |