Anti PLCG1 pAb (ATL-HPA036682)

Atlas Antibodies

Catalog No.:
ATL-HPA036682-25
Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: phospholipase C, gamma 1
Gene Name: PLCG1
Alternative Gene Name: NCKAP3, PLC-II, PLC1, PLC148, PLCgamma1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016933: 93%, ENSRNOG00000051490: 94%
Entrez Gene ID: 5335
Uniprot ID: P19174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNG
Gene Sequence ENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNG
Gene ID - Mouse ENSMUSG00000016933
Gene ID - Rat ENSRNOG00000051490
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLCG1 pAb (ATL-HPA036682)
Datasheet Anti PLCG1 pAb (ATL-HPA036682) Datasheet (External Link)
Vendor Page Anti PLCG1 pAb (ATL-HPA036682) at Atlas Antibodies

Documents & Links for Anti PLCG1 pAb (ATL-HPA036682)
Datasheet Anti PLCG1 pAb (ATL-HPA036682) Datasheet (External Link)
Vendor Page Anti PLCG1 pAb (ATL-HPA036682)
!