Anti PLCE1 pAb (ATL-HPA015597)

Atlas Antibodies

Catalog No.: ATL-HPA015597-25

Protein Description: phospholipase C, epsilon 1
Gene Name: PLCE1
Alternative Gene Name: KIAA1516, NPHS3, PLCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024998: 59%, ENSRNOG00000014276: 57%
Entrez Gene ID: 51196
Uniprot ID: Q9P212
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKT
• Gene Sequence: MGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKT
• Gene ID - Mouse: ENSMUSG00000024998
• Gene ID - Rat: ENSRNOG00000014276
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLCE1 pAb (ATL-HPA015597) – 3 Found

Wakita, Masahiro; Edamatsu, Hironori; Li, Mingzhen; Emi, Aki; Kitazawa, Sohei; Kataoka, Tohru. Phospholipase Cϵ Activates Nuclear Factor-κB Signaling by Causing Cytoplasmic Localization of Ribosomal S6 Kinase and Facilitating Its Phosphorylation of Inhibitor κB in Colon Epithelial Cells. The Journal Of Biological Chemistry. 2016;291(24):12586-12600. 

Liang, Zhen-Xing; Liu, Hua-Shan; Xiong, Li; Yang, Xin; Wang, Feng-Wei; Zeng, Zi-Wei; He, Xiao-Wen; Wu, Xian-Rui; Lan, Ping. A novel NF-κB regulator encoded by circPLCE1 inhibits colorectal carcinoma progression by promoting RPS3 ubiquitin-dependent degradation. Molecular Cancer. 2021;20(1):103. 

Inaba, Hironori; Miao, Qianqian; Nakata, Takao. Optogenetic control of small GTPases reveals RhoA mediates intracellular calcium signaling. The Journal Of Biological Chemistry. 2021;296( 33453281):100290.