Anti PLCD3 pAb (ATL-HPA053665)

Atlas Antibodies

Catalog No.:
ATL-HPA053665-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: phospholipase C delta 3
Gene Name: PLCD3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020937: 96%, ENSRNOG00000003033: 95%
Entrez Gene ID: 113026
Uniprot ID: Q8N3E9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGHQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFK
Gene Sequence EGHQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFK
Gene ID - Mouse ENSMUSG00000020937
Gene ID - Rat ENSRNOG00000003033
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLCD3 pAb (ATL-HPA053665)
Datasheet Anti PLCD3 pAb (ATL-HPA053665) Datasheet (External Link)
Vendor Page Anti PLCD3 pAb (ATL-HPA053665) at Atlas Antibodies

Documents & Links for Anti PLCD3 pAb (ATL-HPA053665)
Datasheet Anti PLCD3 pAb (ATL-HPA053665) Datasheet (External Link)
Vendor Page Anti PLCD3 pAb (ATL-HPA053665)