Anti PLCB4 pAb (ATL-HPA007951)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007951-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PLCB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039943: 98%, ENSRNOG00000033119: 98%
Entrez Gene ID: 5332
Uniprot ID: Q15147
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKL |
| Gene Sequence | SLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKL |
| Gene ID - Mouse | ENSMUSG00000039943 |
| Gene ID - Rat | ENSRNOG00000033119 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLCB4 pAb (ATL-HPA007951) | |
| Datasheet | Anti PLCB4 pAb (ATL-HPA007951) Datasheet (External Link) |
| Vendor Page | Anti PLCB4 pAb (ATL-HPA007951) at Atlas Antibodies |
| Documents & Links for Anti PLCB4 pAb (ATL-HPA007951) | |
| Datasheet | Anti PLCB4 pAb (ATL-HPA007951) Datasheet (External Link) |
| Vendor Page | Anti PLCB4 pAb (ATL-HPA007951) |
| Citations for Anti PLCB4 pAb (ATL-HPA007951) – 1 Found |
| Phan, Hoa T N; Loomis, Joseph; Abraham, Saji; He, Qing; Bastepe, Murat; Smrcka, Alan V. A naturally occurring membrane-anchored Gα(s) variant, XLα(s), activates phospholipase Cβ4. The Journal Of Biological Chemistry. 2022;298(8):102134. PubMed |