Anti PLAU pAb (ATL-HPA070796)

Atlas Antibodies

Catalog No.:
ATL-HPA070796-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: plasminogen activator, urokinase
Gene Name: PLAU
Alternative Gene Name: UPA, URK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021822: 70%, ENSRNOG00000010516: 70%
Entrez Gene ID: 5328
Uniprot ID: P00749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYP
Gene Sequence KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYP
Gene ID - Mouse ENSMUSG00000021822
Gene ID - Rat ENSRNOG00000010516
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLAU pAb (ATL-HPA070796)
Datasheet Anti PLAU pAb (ATL-HPA070796) Datasheet (External Link)
Vendor Page Anti PLAU pAb (ATL-HPA070796) at Atlas Antibodies

Documents & Links for Anti PLAU pAb (ATL-HPA070796)
Datasheet Anti PLAU pAb (ATL-HPA070796) Datasheet (External Link)
Vendor Page Anti PLAU pAb (ATL-HPA070796)