Anti PLAT pAb (ATL-HPA003412)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003412-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PLAT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031538: 74%, ENSRNOG00000019018: 77%
Entrez Gene ID: 5327
Uniprot ID: P00750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLF |
| Gene Sequence | KYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLF |
| Gene ID - Mouse | ENSMUSG00000031538 |
| Gene ID - Rat | ENSRNOG00000019018 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLAT pAb (ATL-HPA003412) | |
| Datasheet | Anti PLAT pAb (ATL-HPA003412) Datasheet (External Link) |
| Vendor Page | Anti PLAT pAb (ATL-HPA003412) at Atlas Antibodies |
| Documents & Links for Anti PLAT pAb (ATL-HPA003412) | |
| Datasheet | Anti PLAT pAb (ATL-HPA003412) Datasheet (External Link) |
| Vendor Page | Anti PLAT pAb (ATL-HPA003412) |
| Citations for Anti PLAT pAb (ATL-HPA003412) – 3 Found |
| Wang, Xuanbin; Wang, Ning; Li, Hongliang; Liu, Ming; Cao, Fengjun; Yu, Xianjun; Zhang, Jingxuan; Tan, Yan; Xiang, Longchao; Feng, Yibin. Up-Regulation of PAI-1 and Down-Regulation of uPA Are Involved in Suppression of Invasiveness and Motility of Hepatocellular Carcinoma Cells by a Natural Compound Berberine. International Journal Of Molecular Sciences. 2016;17(4):577. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Fan, Li-Ching; Jeng, Yung-Ming; Lu, Yueh-Tong; Lien, Huang-Chun. SPOCK1 Is a Novel Transforming Growth Factor-β-Induced Myoepithelial Marker That Enhances Invasion and Correlates with Poor Prognosis in Breast Cancer. Plos One. 11(9):e0162933. PubMed |