Anti PLAGL1 pAb (ATL-HPA055706)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055706-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PLAGL1
Alternative Gene Name: LOT1, ZAC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019817: 50%, ENSRNOG00000025587: 47%
Entrez Gene ID: 5325
Uniprot ID: Q9UM63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSP |
| Gene Sequence | QELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSP |
| Gene ID - Mouse | ENSMUSG00000019817 |
| Gene ID - Rat | ENSRNOG00000025587 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLAGL1 pAb (ATL-HPA055706) | |
| Datasheet | Anti PLAGL1 pAb (ATL-HPA055706) Datasheet (External Link) |
| Vendor Page | Anti PLAGL1 pAb (ATL-HPA055706) at Atlas Antibodies |
| Documents & Links for Anti PLAGL1 pAb (ATL-HPA055706) | |
| Datasheet | Anti PLAGL1 pAb (ATL-HPA055706) Datasheet (External Link) |
| Vendor Page | Anti PLAGL1 pAb (ATL-HPA055706) |
| Citations for Anti PLAGL1 pAb (ATL-HPA055706) – 1 Found |
| Keck, Michaela-Kristina; Sill, Martin; Wittmann, Andrea; Joshi, Piyush; Stichel, Damian; Beck, Pengbo; Okonechnikow, Konstantin; Sievers, Philipp; Wefers, Annika K; Roncaroli, Federico; Avula, Shivaram; McCabe, Martin G; Hayden, James T; Wesseling, Pieter; Øra, Ingrid; Nistér, Monica; Kranendonk, Mariëtte E G; Tops, Bastiaan B J; Zapotocky, Michal; Zamecnik, Josef; Vasiljevic, Alexandre; Fenouil, Tanguy; Meyronet, David; von Hoff, Katja; Schüller, Ulrich; Loiseau, Hugues; Figarella-Branger, Dominique; Kramm, Christof M; Sturm, Dominik; Scheie, David; Rauramaa, Tuomas; Pesola, Jouni; Gojo, Johannes; Haberler, Christine; Brandner, Sebastian; Jacques, Tom; Sexton Oates, Alexandra; Saffery, Richard; Koscielniak, Ewa; Baker, Suzanne J; Yip, Stephen; Snuderl, Matija; Ud Din, Nasir; Samuel, David; Schramm, Kathrin; Blattner-Johnson, Mirjam; Selt, Florian; Ecker, Jonas; Milde, Till; von Deimling, Andreas; Korshunov, Andrey; Perry, Arie; Pfister, Stefan M; Sahm, Felix; Solomon, David A; Jones, David T W. Amplification of the PLAG-family genes-PLAGL1 and PLAGL2-is a key feature of the novel tumor type CNS embryonal tumor with PLAGL amplification. Acta Neuropathologica. 2023;145(1):49-69. PubMed |