Anti PLAG1 pAb (ATL-HPA072290)

Atlas Antibodies

Catalog No.: ATL-HPA072290-25

Protein Description: pleiomorphic adenoma gene 1
Gene Name: PLAG1
Alternative Gene Name: ZNF912
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003282: 98%, ENSRNOG00000008846: 97%
Entrez Gene ID: 5324
Uniprot ID: Q6DJT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQ
• Gene Sequence: EPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQ
• Gene ID - Mouse: ENSMUSG00000003282
• Gene ID - Rat: ENSRNOG00000008846
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.