Anti PLAG1 pAb (ATL-HPA072290)

Atlas Antibodies

Catalog No.:
ATL-HPA072290-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pleiomorphic adenoma gene 1
Gene Name: PLAG1
Alternative Gene Name: ZNF912
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003282: 98%, ENSRNOG00000008846: 97%
Entrez Gene ID: 5324
Uniprot ID: Q6DJT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQ
Gene Sequence EPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQ
Gene ID - Mouse ENSMUSG00000003282
Gene ID - Rat ENSRNOG00000008846
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLAG1 pAb (ATL-HPA072290)
Datasheet Anti PLAG1 pAb (ATL-HPA072290) Datasheet (External Link)
Vendor Page Anti PLAG1 pAb (ATL-HPA072290) at Atlas Antibodies

Documents & Links for Anti PLAG1 pAb (ATL-HPA072290)
Datasheet Anti PLAG1 pAb (ATL-HPA072290) Datasheet (External Link)
Vendor Page Anti PLAG1 pAb (ATL-HPA072290)