Anti PLAAT3 pAb (ATL-HPA011749)

Atlas Antibodies

Catalog No.:
ATL-HPA011749-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phospholipase A2 group XVI
Gene Name: PLAAT3
Alternative Gene Name: AdPLA, H-REV107-1, HRASLS3, HREV107, HREV107-3, MGC118754., PLA2G16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060675: 87%, ENSRNOG00000021206: 87%
Entrez Gene ID: 11145
Uniprot ID: P53816
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD
Gene Sequence PPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD
Gene ID - Mouse ENSMUSG00000060675
Gene ID - Rat ENSRNOG00000021206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLAAT3 pAb (ATL-HPA011749)
Datasheet Anti PLAAT3 pAb (ATL-HPA011749) Datasheet (External Link)
Vendor Page Anti PLAAT3 pAb (ATL-HPA011749) at Atlas Antibodies

Documents & Links for Anti PLAAT3 pAb (ATL-HPA011749)
Datasheet Anti PLAAT3 pAb (ATL-HPA011749) Datasheet (External Link)
Vendor Page Anti PLAAT3 pAb (ATL-HPA011749)