Anti PLAAT3 pAb (ATL-HPA011749)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011749-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PLAAT3
Alternative Gene Name: AdPLA, H-REV107-1, HRASLS3, HREV107, HREV107-3, MGC118754., PLA2G16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060675: 87%, ENSRNOG00000021206: 87%
Entrez Gene ID: 11145
Uniprot ID: P53816
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD |
| Gene Sequence | PPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD |
| Gene ID - Mouse | ENSMUSG00000060675 |
| Gene ID - Rat | ENSRNOG00000021206 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLAAT3 pAb (ATL-HPA011749) | |
| Datasheet | Anti PLAAT3 pAb (ATL-HPA011749) Datasheet (External Link) |
| Vendor Page | Anti PLAAT3 pAb (ATL-HPA011749) at Atlas Antibodies |
| Documents & Links for Anti PLAAT3 pAb (ATL-HPA011749) | |
| Datasheet | Anti PLAAT3 pAb (ATL-HPA011749) Datasheet (External Link) |
| Vendor Page | Anti PLAAT3 pAb (ATL-HPA011749) |