Anti PLA2G4A pAb (ATL-HPA054206)

Atlas Antibodies

Catalog No.:
ATL-HPA054206-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: phospholipase A2, group IVA (cytosolic, calcium-dependent)
Gene Name: PLA2G4A
Alternative Gene Name: cPLA2-alpha, PLA2G4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056220: 93%, ENSRNOG00000002657: 93%
Entrez Gene ID: 5321
Uniprot ID: P47712
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSK
Gene Sequence PRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSK
Gene ID - Mouse ENSMUSG00000056220
Gene ID - Rat ENSRNOG00000002657
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLA2G4A pAb (ATL-HPA054206)
Datasheet Anti PLA2G4A pAb (ATL-HPA054206) Datasheet (External Link)
Vendor Page Anti PLA2G4A pAb (ATL-HPA054206) at Atlas Antibodies

Documents & Links for Anti PLA2G4A pAb (ATL-HPA054206)
Datasheet Anti PLA2G4A pAb (ATL-HPA054206) Datasheet (External Link)
Vendor Page Anti PLA2G4A pAb (ATL-HPA054206)