Anti PLA2G4A pAb (ATL-HPA054206)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054206-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PLA2G4A
Alternative Gene Name: cPLA2-alpha, PLA2G4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056220: 93%, ENSRNOG00000002657: 93%
Entrez Gene ID: 5321
Uniprot ID: P47712
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSK |
Gene Sequence | PRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSK |
Gene ID - Mouse | ENSMUSG00000056220 |
Gene ID - Rat | ENSRNOG00000002657 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PLA2G4A pAb (ATL-HPA054206) | |
Datasheet | Anti PLA2G4A pAb (ATL-HPA054206) Datasheet (External Link) |
Vendor Page | Anti PLA2G4A pAb (ATL-HPA054206) at Atlas Antibodies |
Documents & Links for Anti PLA2G4A pAb (ATL-HPA054206) | |
Datasheet | Anti PLA2G4A pAb (ATL-HPA054206) Datasheet (External Link) |
Vendor Page | Anti PLA2G4A pAb (ATL-HPA054206) |