Anti PLA2G4A pAb (ATL-HPA054206)

Atlas Antibodies

SKU: ATL-HPA054206-25

• 
• 

Protein Description: phospholipase A2, group IVA (cytosolic, calcium-dependent)
Gene Name: PLA2G4A
Alternative Gene Name: cPLA2-alpha, PLA2G4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056220: 93%, ENSRNOG00000002657: 93%
Entrez Gene ID: 5321
Uniprot ID: P47712
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSK
• Gene Sequence: PRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSK
• Gene ID - Mouse: ENSMUSG00000056220
• Gene ID - Rat: ENSRNOG00000002657
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.