Anti PLA2G12B pAb (ATL-HPA059562)

Atlas Antibodies

Catalog No.:
ATL-HPA059562-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phospholipase A2, group XIIB
Gene Name: PLA2G12B
Alternative Gene Name: PLA2G13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009646: 100%, ENSRNOG00000046619: 100%
Entrez Gene ID: 84647
Uniprot ID: Q9BX93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFV
Gene Sequence MDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFV
Gene ID - Mouse ENSMUSG00000009646
Gene ID - Rat ENSRNOG00000046619
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLA2G12B pAb (ATL-HPA059562)
Datasheet Anti PLA2G12B pAb (ATL-HPA059562) Datasheet (External Link)
Vendor Page Anti PLA2G12B pAb (ATL-HPA059562) at Atlas Antibodies

Documents & Links for Anti PLA2G12B pAb (ATL-HPA059562)
Datasheet Anti PLA2G12B pAb (ATL-HPA059562) Datasheet (External Link)
Vendor Page Anti PLA2G12B pAb (ATL-HPA059562)