Anti PLA2G12B pAb (ATL-HPA059562)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059562-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PLA2G12B
Alternative Gene Name: PLA2G13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009646: 100%, ENSRNOG00000046619: 100%
Entrez Gene ID: 84647
Uniprot ID: Q9BX93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFV |
| Gene Sequence | MDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFV |
| Gene ID - Mouse | ENSMUSG00000009646 |
| Gene ID - Rat | ENSRNOG00000046619 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLA2G12B pAb (ATL-HPA059562) | |
| Datasheet | Anti PLA2G12B pAb (ATL-HPA059562) Datasheet (External Link) |
| Vendor Page | Anti PLA2G12B pAb (ATL-HPA059562) at Atlas Antibodies |
| Documents & Links for Anti PLA2G12B pAb (ATL-HPA059562) | |
| Datasheet | Anti PLA2G12B pAb (ATL-HPA059562) Datasheet (External Link) |
| Vendor Page | Anti PLA2G12B pAb (ATL-HPA059562) |