Anti PLA2G12B pAb (ATL-HPA057745)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057745-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PLA2G12B
Alternative Gene Name: PLA2G13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009646: 88%, ENSRNOG00000046619: 91%
Entrez Gene ID: 84647
Uniprot ID: Q9BX93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESM |
Gene Sequence | DTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESM |
Gene ID - Mouse | ENSMUSG00000009646 |
Gene ID - Rat | ENSRNOG00000046619 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PLA2G12B pAb (ATL-HPA057745) | |
Datasheet | Anti PLA2G12B pAb (ATL-HPA057745) Datasheet (External Link) |
Vendor Page | Anti PLA2G12B pAb (ATL-HPA057745) at Atlas Antibodies |
Documents & Links for Anti PLA2G12B pAb (ATL-HPA057745) | |
Datasheet | Anti PLA2G12B pAb (ATL-HPA057745) Datasheet (External Link) |
Vendor Page | Anti PLA2G12B pAb (ATL-HPA057745) |