Anti PKP4 pAb (ATL-HPA066647)

Atlas Antibodies

Catalog No.:
ATL-HPA066647-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: plakophilin 4
Gene Name: PKP4
Alternative Gene Name: p0071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026991: 89%, ENSRNOG00000005504: 90%
Entrez Gene ID: 8502
Uniprot ID: Q99569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYSDSGYQEAGSFHNSQNVSKADNRQQHSFIGSTNNHVVRNSRAEGQTLVQPSVANRAMRRVSSVPSRAQSPSYVISTGVSPSR
Gene Sequence SYSDSGYQEAGSFHNSQNVSKADNRQQHSFIGSTNNHVVRNSRAEGQTLVQPSVANRAMRRVSSVPSRAQSPSYVISTGVSPSR
Gene ID - Mouse ENSMUSG00000026991
Gene ID - Rat ENSRNOG00000005504
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PKP4 pAb (ATL-HPA066647)
Datasheet Anti PKP4 pAb (ATL-HPA066647) Datasheet (External Link)
Vendor Page Anti PKP4 pAb (ATL-HPA066647) at Atlas Antibodies

Documents & Links for Anti PKP4 pAb (ATL-HPA066647)
Datasheet Anti PKP4 pAb (ATL-HPA066647) Datasheet (External Link)
Vendor Page Anti PKP4 pAb (ATL-HPA066647)